PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P12010_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TCP
Protein Properties Length: 1674aa    MW: 185094 Da    PI: 6.7727
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P12010_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1103.6e-3414211487672
                    TCP    6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72  
                             +r++++hTkv+gR+RR+R++a caar+F+L++eLG+++d++ti WLl+ a+pai+++tgt++ +a +
  GSMUA_Achr8P12010_001 1421 SRTKDRHTKVEGRGRRIRMPAACAARIFQLTRELGHKSDGETIKWLLEHAEPAIIAATGTGTVPAIA 1487
                             69**********************************************************8877733 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF644841.08E-12341537No hitNo description
SMARTSM006631.8E-2385371IPR006592RNA polymerase, N-terminal
PfamPF006236.9E-28185342IPR000722RNA polymerase, alpha subunit
Gene3DG3DSA:2.40.40.205.4E-19192216No hitNo description
Gene3DG3DSA:2.40.40.205.4E-19273345No hitNo description
PfamPF049833.7E-17347494IPR007066RNA polymerase Rpb1, domain 3
PfamPF050003.1E-7565617IPR007083RNA polymerase Rpb1, domain 4
SuperFamilySSF644841.08E-123568622No hitNo description
SuperFamilySSF644841.08E-123656805No hitNo description
SuperFamilySSF644841.08E-12310051136No hitNo description
PfamPF049985.4E-510071079IPR007081RNA polymerase Rpb1, domain 5
Gene3DG3DSA:3.10.450.403.6E-2712471343No hitNo description
PfamPF115232.2E-2212651338IPR021602Protein of unknown function DUF3223
PfamPF036343.5E-2814221489IPR005333Transcription factor, TCP
PROSITE profilePS5136926.77714231477IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0010495Biological Processlong-distance posttranscriptional gene silencing
GO:0030422Biological Processproduction of siRNA involved in RNA interference
GO:0000418Cellular ComponentDNA-directed RNA polymerase IV complex
GO:0003677Molecular FunctionDNA binding
GO:0003899Molecular FunctionDNA-directed RNA polymerase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1674 aa     Download sequence    Send to blast
MLKKILRVSR WPINIFIYVA NLKISRDIMT FVIVGVKMLL SVLSAIFLYY FIYYWLNINI  60
FCFQVFCLLS ELDPEFIQQF VSRRELLFLS YLPITPNCQR VVETSHVFAD GPKLSFDERT  120
RAYKRLADVS KKIGDTLLAA INFSKLYSGT AVVLFDHQSN LHASSSSRGD STSGIRWLKD  180
VVLSKRTDNV FRMTMVGDPK IKLQEIGIPF DISESLIVAE QVNSYNLEKL NMSCNLHLLR  240
KEGLNTRSKG QLTSLHKTNQ LQVGDIVSRP LENGDIILVN RPPSVHQHSL IALSVMILPI  300
QSVISINPLC CAPLLGDFDG DCLHGYVPQS IGCRVELQEL LSLDHQLFNA QDGRSLVSLT  360
HDSLTAAYLL TANREFLNKV DMQQLAMLCP FPMPPPAVVK TPKFQIPLWT GEQLFSMLLP  420
PTMDFGVNSR NMISKGEVMA SLGGSFWLQN TTTGLFTTMF KHYGRKALDY LCCSQELLCE  480
YLTLRGLSVS LGDVYLSSDS YSRLKMMDEI YFGLEEAEDA CQVMQLMLEP EMEILRNQNK  540
DEDTLDCISQ YKIASERTCV SQVSIAAFKN VYHDLLSQIY QFINKDNSML EMIDAGSKGS  600
LVKLIQQGAC LGLQLFAHPL PFTVPSKLNC CMWNNLKALD GGISDAAKSS CGQSSYAVIG  660
TSFLDGLNPL ECFVHAICGR ANLFTENAEL PGTLTRKLMF YMRDLYLAYD GTVRSAYGQQ  720
IVEFSYSILE DSTEGGESCV AYDGKDAEYT GLGGEPVGSW AACSISEAAY GSLEFPMNSL  780
EYSPLMKLKM VLDCCKSNAS TNHTALLFLS KRLHGWRYGC EYGALEVKNH LERVCFFNLI  840
ITVMILYDGH DVQGTNFSPW IMHFHVSKDK MLRRRLNVQL VKNELIKHYN CMRERMNPML  900
PRLCFVSKNC SSAYKWKEHD DSFCMSVAAE TSESLIQLDT IRDMVIPLLL ETPIKGFWAS  960
EKVEILCESL PGSGSELFLR VTMSKKCLPG SFWSDLQDAC IPIMDLIDWQ CSHPDNVYNI  1020
SGTYGIDAAW KYFVKSLKSV TADIGRDIHK RHLFMAADCL SVTGEFHGLS TKGLRQQRND  1080
MSISSPFAQA CLSNPVNCFV NAAKQGSMDH LSGTLDAVAW GKEAPSGTGG PFEIVYSGKV  1140
HNLTRGEGIY KNLHSIKAEL QQGDGEVCMA ANQTVPAKWK QQPKYSTNFD GAKETIDPQT  1200
SDEDHLKERI VSKFRTNCKG YNKQQQISAN DFLAKSHLTF GLRSKFSSES VSSWTDVVDM  1260
CSSLRTILYK YPIDGFLDEK DNSSLIEALN YHPKRAAKIG SGIQKIKVGC SPLHPGSRCF  1320
VLLRSDGSLE DFSYRKCVVG AAKLISPEFG SIRVRWGDME TQKRDEEVWQ RKATGGGGRS  1380
LSGVAVPSPG AIPVHRIIVP KPEPIEMLGV GAFQIVRRPA SRTKDRHTKV EGRGRRIRMP  1440
AACAARIFQL TRELGHKSDG ETIKWLLEHA EPAIIAATGT GTVPAIATNV GGTLKIPTEA  1500
PTSAPVSSTS TIDPLLPVGG AISISSGLAP IGPGAQGMMP MWTLGGDAAG ASMIPPGALW  1560
VLPPPSVAVA PSSQSQIWTF PRAPQIINLT AVRPVSTETR FTTTASGVNV ARAAEVQHSA  1620
APPVAAAYAP ATGGKQELQL MSNPGALRRG QVHELDDYED DEDDDDDDDS SAED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3h0g_M1e-46178726342874DNA-directed RNA polymerase II subunit rpb1
3h0g_A1e-46178726342874DNA-directed RNA polymerase II subunit rpb1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1868874DKMLRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009411449.10.0PREDICTED: DNA-directed RNA polymerase IV subunit 1 isoform X1
RefseqXP_009411450.10.0PREDICTED: DNA-directed RNA polymerase IV subunit 1 isoform X1
RefseqXP_009411451.10.0PREDICTED: DNA-directed RNA polymerase IV subunit 1 isoform X1
TrEMBLM0TPQ40.0M0TPQ4_MUSAM; DNA-directed RNA polymerase subunit
STRINGGSMUA_Achr8P12010_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.12e-42TCP family protein